Back

Open Dataset XSWGFZWZ


S. aureus Extracellular Adherence Protein, Domains 3 and 4 Truncation

Abstract

This entry contains SEC-SAXS data collected on samples of domains 3 and 4 of Eap from S. aureus strain Mu50. Models and interpretation of the data are available at the Small Angle Scattering Biological Data Bank (SASBDB) under entry SASDVN2. The reference for the journal article is: Mishra et al (2024) "S. aureus Eap is a polyvalent inhibitor of neutrophil serine proteases" J. Biol. Chem 300: 107627.

Experimental description

Data were collected at SIBYLS beamline 12.3.1 at Advanced Light Source in SEC-SAXS mode. SEC running buffer was 20 mM acetate (pH 4.0), 100 mM L-Arginine, 100 mM L-Glutamic acid, 300 mM NaCl, 1% (v/v) glycerol. The Shodex 803 SEC column was equilibrated with running buffer with a flow rate of 0.65 mL/min. Following injection of the sample, two second X-ray exposures were recorded continuously for 25 min. The X-ray wavelength was set at λ=1.127 Å, and the sample to detector distance was 2100 mm, resulting in scattering vectors, q, ranging from 0.01 Å-1 to 0.45 Å-1.

File description

Eap34_1_00001.dat through Eap34_1_00660.dat represent successive small-angle X-ray scattering data collections every 2 seconds as the samples elute from the size-exclusion column. File Eap34_1_00001.dat is the first exposure, and Eap34_1_00660.dat is the last.

Created

2023-12-12

Published

2024-09-10

Data collection technique

SEC-SAXS

Journal DOI

https://doi.org/doi: 10.1016/j.jbc.2024.107627

Source

Advanced Light Source

Beamline

SIBYLS BL12.3.1

Wavelength

1.127 Å

Sample to Detector Distance

2.1 m


Submitting Author

N. Mishra

Kansas State University

United States of America

Collaborators

Project Leader

B. Geisbrecht


Data Download Terms:

The data available for download is free to use, however by clicking a download link, it signifies that you agree to our Terms of Service and Privacy Policy.


Complete Set of SAS Data Files

The complete SAS dataset is downloadable as a zip file.


Individual SAS Data Files (Total: 0)

These are individual SAS data files that may be raw or processed (merged, etc.). These may or not be included in a zip file containing a larger dataset.


Supplemental Data and Supporting Materials (Total: 0)

These data and materials may include X-ray crystal structure coordinates, multi-angle light scattering data, .etc. It may also include additional details or methods pertaining to the SAXS experiments, or the researcher's interpretations of the results.


Open SAXS data analysis sites in a new tab using these links

SAXS Similarity SAXS FrameSlice


Sample:

  • Macromolecule 1: Eap34
    • Sample Full Name: Extracellular adherence protein, domains 3 and 4 truncation
    • Sample Type: Protein
    • Source Organism: Staphylococcus aureus strain Mu50
    • Source Organism NCBI Taxonomy ID: 158878
    • Expression System: Escherichia coli BL21(DE3)
    • Expression NCBI Taxonomy ID: 469008
    • Uniprot ID: Q99QS1
    • Sequence or Chemical Formula:
    • GSTYQVPYSINLNGTSTNILSNLSFSNKPWTNYKNLTSQIKSVLKHDRGISEQDLKYAKKAYYTVYFKNGGKRILQLNSKNYTANLVHAKDVKRIEITVKTGTKAKADRYVPYTIAVNGTSTPILSKLKISNKQLISYKYLNDKVKSVLKSERGISDLDLKFAKQAKYTVYFKNGKKQVVNLKSDIFTPNLFSAKDIKKIDIDVKQYTKSKKK