Back

Open Dataset XS4FJZBK


CHCHD4 Chaperone and AIF-interaction Mutants

Abstract

This dataset reports X-ray scattering profiles for a panel of CHCHD4 mutants targeting the N-terminal AIF-interaction motif. SAXS analysis indicates that CHCHD4 mutants most defective for AIF interaction exhibit a more extended architecture relative to the wild-type protein. Complementary NMR studies ultimately revealed that the N-terminal interaction domain contacts and shields CHCHD4’s central catalytic domain; thus mutations to the N-terminus interfere with this intramolecular regulatory interaction. Additional analyses for these SAXS data may be found at the SASBDB with entries SASDVY6 (CHCHD4-WT), SASDVY6 (I12A/F14A/H20A), SASDV27 (H20D), SASDV37 (L28D). This dataset is described in further detail in Brosey CA, Shen R, and Tainer JA, The EMBO Journal, 2025.

Experimental description

Wild-type and mutant CHCHD4 constructs were expressed and purified as described in Brosey et al, Nature Chemical Biology, 2024. Purified wild-type and mutant CHCHD4 were exchanged into SAXS buffer (25 mM HEPES, 150 mM NaCl, 2 mM TCEP, pH 7.5) by size-exclusion chromatography (Superdex 75 10/300) to ensure monodisperse protein. Peak CHCHD4 fractions from Superdex 75 purifications were pooled (1.5-2.0 mL), concentrated to 3-7.3 mg/mL in 4-mL Amicon ultra centrifugal filters concentrators with 10-kDa molecular-weight cut-off limits (Millipore-Sigma), then diluted into concentration series of 0.6-7.3 mg/mL. Samples were transferred into 96-well PCR plates with matched buffers eluted from the protein-free void volume or collected from concentration flowthroughs. Plates were flash frozen in liquid nitrogen and shipped on dry ice for mail-in HT-SAXS data collection at ALS beamline 12.3.1 (SIBYLS) at Lawrence Berkeley National Laboratory.

File description

The zip file contains scattering curves (averaged across 0.3 s frames by SAXS FrameSlice) for wild-type CHCHD4 (CHCHD4-WT.dat) and mutants I12A/F14A/H20A (CHCHD4-AIA-A.dat), H20D (CHCHD4-H20D.dat), and L28D (CHCHD4-L28D.dat).

Created

2024-03-30

Published

2025-03-04

Data collection technique

HT-SAXS

Journal DOI

https://doi.org/10.1038/s44318-024-00360-6

Source

Advanced Light Source

Beamline

SIBYLS BL12.3.1

Wavelength

1.23 Å

Sample to Detector Distance

2.0 m


Submitting Author

Chris Brosey

University of Texas MD Anderson Cancer Center

United States of America

[email protected]

Collaborators

Project Leader

John Tainer

[email protected]


Data Download Terms:

The data available for download is free to use, however by clicking a download link, it signifies that you agree to our Terms of Service and Privacy Policy.


Complete Set of SAS Data Files

The complete SAS dataset is downloadable as a zip file.


Individual SAS Data Files (Total: 0)

These are individual SAS data files that may be raw or processed (merged, etc.). These may or not be included in a zip file containing a larger dataset.


Supplemental Data and Supporting Materials (Total: 0)

These data and materials may include X-ray crystal structure coordinates, multi-angle light scattering data, .etc. It may also include additional details or methods pertaining to the SAXS experiments, or the researcher's interpretations of the results.


Open SAXS data analysis sites in a new tab using these links

SAXS Similarity SAXS FrameSlice


Samples:

  • Macromolecule 1: CHCHD4
    • Sample Full Name: Coiled-coil-helix-coiled-coil-helix domain
    • Sample Type: Protein
    • Source Organism: Homo sapiens
    • Source Organism NCBI Taxonomy ID: 1758
    • Expression System: Escherichia coli
    • Expression NCBI Taxonomy ID: 562
    • Uniprot ID: Q8N4Q1
    • Sequence or Chemical Formula:
    • GPMSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEGSS
  • Macromolecule 2: CHCHD4-I12A-F14A-H20A
    • Sample Full Name: Coiled-coil-helix-coiled-coil-helix domain I12A/F14A/H20A
    • Sample Type: Protein
    • Source Organism: Homo sapiens
    • Source Organism NCBI Taxonomy ID: 1758
    • Expression System: Escherichia coli
    • Expression NCBI Taxonomy ID: 562
    • Uniprot ID: Q8N4Q1
    • Sequence or Chemical Formula:
    • GPMSYCRQEGKDRAIAVTKEDAETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEGSS
  • Macromolecule 3: CHCHD4-H20D
    • Sample Full Name: Coiled-coil-helix-coiled-coil-helix domain H20D
    • Sample Type: Protein
    • Source Organism: Homo sapiens
    • Source Organism NCBI Taxonomy ID: 1758
    • Expression System: Escherichia coli
    • Expression NCBI Taxonomy ID: 562
    • Uniprot ID: Q8N4Q1
    • Sequence or Chemical Formula:
    • GPMSYCRQEGKDRIIFVTKEDDETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEGSS
  • Macromolecule 4: CHCHD4-L28D
    • Sample Full Name: Coiled-coil-helix-coiled-coil-helix domain L28D
    • Sample Type: Protein
    • Source Organism: Homo sapiens
    • Source Organism NCBI Taxonomy ID: 1758
    • Expression System: Escherichia coli
    • Expression NCBI Taxonomy ID: 562
    • Uniprot ID: Q8N4Q1
    • Sequence or Chemical Formula:
    • GPMSYCRQEGKDRIIFVTKEDHETPSSAEDVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEGSS